Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a)

UniProt : Q53YA0, UniProt ID: Q53YA0_HUMAN,

Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a)

Homo sapiens

MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSS
VSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK
DVGSKGKVGRLSAPGSQREGRNPQLNQQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a) contains a PF02044 domain.

Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a) is proteolytically cut by meprin beta subunit (M12.004) cleavage. LTKM-YPRG.

Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a) is proteolytically cut by meprin beta subunit (M12.004) cleavage. KMYP-RGNH.

Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a) is proteolytically cut by meprin beta subunit (M12.004) cleavage. MYPR-GNHW.

Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. NHWA-VGHL.

Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. AVGH-LMGK.

Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. RGNH-WAVG.

Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. GNHW-AVGH.

Gastrin-releasing peptide (Gastrin-releasing peptide, isoform CRA_a) is proteolytically cut by meprin alpha subunit (M12.002) cleavage. PRGN-HWAV.