Neurotensin/neuromedin N

UniProt : Q9D3P9, UniProt ID: NEUT_MOUSE,

Neurotensin/neuromedin N

Mus musculus

MRGMNLQLVCLTLLAFSSWSLCSDSEEDVRALEADLLTNMHTSKISKASPPSWKMTLLNV
CSLINNVNSPAEEAGDMHDDDLVGKRKLPLVLDGFSLEAMLTIFQLQKICRSRAFQHWEI
IQEDILDNVNDKNEKEEVIKRKIPYILKRQLYENKPRRPYILKRGSYYY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Neurotensin/neuromedin N contains a PF07421 domain.

Neurotensin/neuromedin N is proteolytically cut by (XM12-001) cleavage. RRPY-IL--.

Neurotensin/neuromedin N is proteolytically cut by (XM02-001) cleavage. RRPY-IL--.

Neurotensin/neuromedin N is proteolytically cut by (S9G.073) cleavage. NKPR-RPYI.

Neurotensin/neuromedin N is proteolytically cut by penicillolysin (M35.001) cleavage. ENKP-RRPY.

Neurotensin/neuromedin N is proteolytically cut by penicillolysin (M35.001) cleavage. NKPR-RPYI.

Neurotensin/neuromedin N is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. PRRP-YIL-.

Neurotensin/neuromedin N is proteolytically cut by neprilysin (M13.001) cleavage. PRRP-YIL-.

Neurotensin/neuromedin N is proteolytically cut by neprilysin (M13.001) cleavage. RRPY-IL--.

Neurotensin/neuromedin N is proteolytically cut by gametolysin (M11.001) cleavage. PRRP-YIL-.

Neurotensin/neuromedin N is proteolytically cut by oligopeptidase F (M03.007) cleavage. PRRP-YIL-.

Neurotensin/neuromedin N is proteolytically cut by oligopeptidase F (M03.007) cleavage. NKPR-RPYI.

Neurotensin/neuromedin N is proteolytically cut by neurolysin (M03.002) cleavage. PRRP-YIL-.

Neurotensin/neuromedin N is proteolytically cut by thimet oligopeptidase (M03.001) cleavage. NKPR-RPYI.

Neurotensin/neuromedin N is proteolytically cut by gingipain K (C25.002) cleavage. YENK-PRRP.

Neurotensin/neuromedin N is proteolytically cut by legumain (C13.004) cleavage. LYEN-KPRR.