Subtilisin BPN'

UniProt : P00782, UniProt ID: SUBT_BACAM,

Subtilisin BPN'

Bacillus amyloliquefaciens

MRGKKVWISLLFALALIFTMAFGSTSSAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVI
SEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAHAYAQSVPYGVSQIKA
PALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVA
ALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSA
ALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVG
PELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENT
TTKLGDSFYYGKGLINVQAAAQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Subtilisin BPN' contains a PF05922 domain.

Subtilisin BPN' contains a PF00082 domain.

Subtilisin BPN' is proteolytically cut by subtilisin BPN' (S08.034) cleavage. FKQT-MSTM.

Subtilisin BPN' is proteolytically cut by subtilisin BPN' (S08.034) cleavage. MSTM-SAAK.

Subtilisin BPN' is proteolytically cut by subtilisin BPN' (S08.034) cleavage. TLNE-KAVK.