SUN family beta-glucosidase-like protein

UniProt : Q59NP5, UniProt ID: Q59NP5_CANAL,

SUN family beta-glucosidase-like protein

Candida albicans

MRFSQATVLAFAALSLAAPAFEADNKNIKREDCDKTSFHGHHKHKRAVAYDYAYVTVTVD
GNGNPITTVSPVLSIETIAKSEETSSTSTSISSTTTIVQNDSLTSDEPKTLSLPSGTIKP
SSFATESQSQSQSSSTGGSGSGSTNGIEGDLAAFEDPTEEFQDGVLSCSDFPSGQGVIPL
DHLGFGGWSGIENSDGSTGGNCKEGSYCSYACQSGMSKTQWPEDQPSNGVSIGGLLCKNG
KLYKSSTRSNYLCEWGVKKANVVNKLSETVAICRTDYPGTENMVIPTVVGGGSTSVITVV
DQSTYYTWRGGATSAQYYVNNAGVSWEDGCVWGTPGSGVGNWAPLNFGAGYANGIAYLSL
IPNPNNRDSLNFKVKIVGESGSTVSGSCSYANGKFNGNSDDGCTVGVTSGEADFVLYN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

SUN family beta-glucosidase-like protein contains a PF03856 domain.

SUN family beta-glucosidase-like protein is proteolytically cut by kexin (S08.070) cleavage. NIKR-EDCD.

SUN family beta-glucosidase-like protein is proteolytically cut by kexin (S08.070) cleavage. KHKR-AVAY.