Probable family 17 glucosidase SCW10

UniProt : Q04951, UniProt ID: SCW10_YEAST,

Probable family 17 glucosidase SCW10

Saccharomyces cerevisiae

MRFSNFLTVSALLTGALGAPAVRHKHEKRDVVTATVHAQVTVVVSGNSGETIVPVNENAV
VATTSSTAVASQATTSTLEPTTSANVVTSQQQTSTLQSSEAASTVGSSTSSSPSSSSSTS
SSASSSASSSISASGAKGITYSPYNDDGSCKSTAQVASDLEQLTGFDNIRLYGVDCSQVE
NVLQAKTSSQKLFLGIYYVDKIQDAVDTIKSAVESYGSWDDITTVSVGNELVNGGSATTT
QVGEYVSTAKSALTSAGYTGSVVSVDTFIAVINNPDLCNYSDYMAVNAHAYFDENTAAQD
AGPWVLEQIERVYTACGGKKDVVITETGWPSKGDTYGEAVPSKANQEAAISSIKSSCGSS
AYLFTAFNDLWKDDGQYGVEKYWGILSSD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Probable family 17 glucosidase SCW10 contains a PF00332 domain.

Probable family 17 glucosidase SCW10 is proteolytically cut by kexin (S08.070) cleavage. HEKR-DVVT.