Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a)

UniProt : B1ANJ4, P09874, UniProt ID: B1ANJ4_HUMAN, PARP1_HUMAN,

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a)

Homo sapiens

MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a) contains a PF08063 domain.

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a) contains a PF05406 domain.

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a) contains a PF02877 domain.

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a) contains a PF00645 domain.

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a) contains a PF00645 domain.

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a) contains a PF00644 domain.

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a) contains a PF00533 domain.

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a) is proteolytically cut by caspase-6 (C14.005) cleavage..

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a) is proteolytically cut by caspase-6 (C14.005) cleavage..

Poly (ADP-ribose) polymerase family, member 1 (Poly (ADP-ribose) polymerase family, member 1, isoform CRA_a) is proteolytically cut by Sat peptidase (S06.004) cleavage..