Mating factor alpha-1

UniProt : P01149, UniProt ID: MFAL1_YEAST,

Mating factor alpha-1

Saccharomyces cerevisiae

MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYLDLEGDFDVAVLPFSNSTN
NGLLFINTTIASIAAKEEGVSLDKREAEAWHWLQLKPGQPMYKREAEAEAWHWLQLKPGQ
PMYKREADAEAWHWLQLKPGQPMYKREADAEAWHWLQLKPGQPMY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Mating factor alpha-1 contains a PF04648 domain.

Mating factor alpha-1 contains a PF04648 domain.

Mating factor alpha-1 contains a PF05436 domain.

Mating factor alpha-1 contains a PF04648 domain.

Mating factor alpha-1 contains a PF04648 domain.

Mating factor alpha-1 is proteolytically cut by barrierpepsin (A01.015) cleavage. WLQL-KPGQ.

Mating factor alpha-1 is proteolytically cut by barrierpepsin (A01.015) cleavage. WLQL-KPGQ.

Mating factor alpha-1 is proteolytically cut by kexin (S08.070) cleavage. LDKR-EAEA.

Mating factor alpha-1 is proteolytically cut by kex carboxypeptidase (S10.007) cleavage. QPMY-K---.

Mating factor alpha-1 is proteolytically cut by kex carboxypeptidase (S10.007) cleavage. PMYK-R---.

Mating factor alpha-1 is proteolytically cut by dipeptidyl aminopeptidase A (S09.005) cleavage. --EA-WHWL.

Mating factor alpha-1 is proteolytically cut by dipeptidyl aminopeptidase A (S09.005) cleavage. --EA-EAWH.

Mating factor alpha-1 is proteolytically cut by kexin (S08.070) cleavage. MYKR-EAEA.

Mating factor alpha-1 is proteolytically cut by kexin (S08.070) cleavage. MYKR-EADA.