Proteolysis inducing factor (Dermcidin)

UniProt : P81605, Q53YJ2, UniProt ID: DCD_HUMAN, Q53YJ2_HUMAN,

Proteolysis inducing factor (Dermcidin)

Homo sapiens

MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRK
QRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Proteolysis inducing factor (Dermcidin) is proteolytically cut by cathepsin D (A01.009) cleavage. VEDL-ESVG.

Proteolysis inducing factor (Dermcidin) is proteolytically cut by cathepsin D (A01.009) cleavage. KDVL-DSVL.