Mating pheromone alpha2 (Strain CBS138 chromosome H complete sequence)

UniProt : Q874M4, UniProt ID: Q874M4_CANGA,

Mating pheromone alpha2 (Strain CBS138 chromosome H complete sequence)

Candida glabrata

MRFLRFISTVALLITGLATAQPVGEELGETVEVPSEAFIGYLDFGATNDVAILPISNKTN
NGLLFVNTTLYNQATKGEKLSDFTKRDANPDAEAEAWHWVKIRKGQGLFRRSADASPEAE
AWHWVRLRKGQGLFRRSADASPEAEAWHWVRLRKGQGLF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Mating pheromone alpha2 (Strain CBS138 chromosome H complete sequence) contains a PF05436 domain.

Mating pheromone alpha2 (Strain CBS138 chromosome H complete sequence) is proteolytically cut by kexin (S08.070) cleavage. FTKR-DANP.

Mating pheromone alpha2 (Strain CBS138 chromosome H complete sequence) is proteolytically cut by kexin (S08.070) cleavage. LFRR-SADA.