Epididymal secretory protein E1

UniProt : P61916, UniProt ID: NPC2_HUMAN,

Epididymal secretory protein E1

Homo sapiens

MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVT
FTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYP
SIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Epididymal secretory protein E1 contains a PF02221 domain.

Epididymal secretory protein E1 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..