Cell wall synthesis protein psu1

UniProt : Q9UR09, UniProt ID: PSU1_SCHPO,

Cell wall synthesis protein psu1

Schizosaccharomyces pombe

MRFFETLALALLTTGALAAPFRHPHHLLNKRDVSVVTSKVYAYTTVTLEAAASAISTNGA
AKEAATAAGDAETTSSVAASVTPAASSSVAASVTPVASSSVAASVTPVSSSAVVDSATSA
AASSSVIPTSSSVVASSSEVASSTTSSAAASATSTGSSSGGFQDGVYDCTDFPSDQSGVV
ALDYLGYGGYSGIQIGDGAGSSCVEGAYCSYACSPGMLKTQWPSTQPSDGETRGGLLCKG
GKLYRTNTAYDNLCENGVGTASVQNTLGQGVAICQTDYPGSENMVIPTYVGGGATSPLSV
TDNANYFQWEGKGTSAQYYVNKAGYTAEQGCQWGTSSGDYGNWSPLVFGAGMTDGTTWLS
ISQNPLTSQLANYNVKIVGADGASVSGTCVFENGAFQNGGSGCTVGITSGSGVFVFY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cell wall synthesis protein psu1 contains a PF03856 domain.

Cell wall synthesis protein psu1 is proteolytically cut by kexin (S08.070) cleavage. LNKR-DVSV.