Protein-lysine 6-oxidase

UniProt : P28300, UniProt ID: LYOX_HUMAN,

Protein-lysine 6-oxidase

Homo sapiens

MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSL
GSQYQPQRRRDPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPT
ARHWFQAGYSTSRAREAGASRAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDD
NPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAA
EENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDE
FSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADID
CQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein-lysine 6-oxidase contains a PF01186 domain.

Protein-lysine 6-oxidase is proteolytically cut by mammalian tolloid-like 2 protein (M12.018) cleavage. GMVG-DDPY.

Protein-lysine 6-oxidase is proteolytically cut by mammalian tolloid-like 1 protein (M12.016) cleavage. GMVG-DDPY.

Protein-lysine 6-oxidase is proteolytically cut by procollagen C-peptidase (M12.005) cleavage. GMVG-DDPY.