ABL203Wp

UniProt : Q75E73, UniProt ID: Q75E73_ASHGO,

ABL203Wp

Ashbya gossypii

MRFATVAGLLPLLQYVTGQVVPAKDHINREYFAVEADGSLEELLEAHPGWQFEHAVRGLE
RHYVLSRVRSELQPRAQVQHKAGGARAWHELVPHRLAKRMPIRDAELGDQLSQRAVLKKE
LNIKDPLFDEQWHLLNTRYPKNDMNVTGLWQKNITGHGIVVAVVDDGLDYESEDLKDNFC
AEGSWDFNSNTALPKPMLSDDTHGTRCAGEIAAAKNQFCGLGVAFNSKVSGIRILSEDIT
PEDEAASLVYGLDINDIYSCSWGPTDNGEELQAPSDLVKKAIIRGVTEGRDRKGALYVFA
SGNGGALGDNCNYDGYTNSIYSITVSALDHRGLHPTYAESCSAVLVVAHSSGSGNFIRTT
DVNGQCFDHHGGTSAAAPLAAGVYALLLQVNPNLTWRDVQYLTILTSIEVNPIQRLQEGS
LGRRYSHKYGYGKLDAYNIVELAKSWKNVNPQAWYYHPTIIANQTIATPDVYIDSTTSVS
RDALDKANLKRVEHVTVTVDIEASIRGFTTVDLIAPNNHISHLGVVRKKDKSHAGFRNWT
FMSVAHWGYAGEGDWKLQVRTTSKKNTVHLKGWRLKLFGESIDASKAVAAEFGNDQEDLQ
DTPTGTSDEPVSSTSTPNSTSTSQDELNTGASKIVPTHHAKNYYLMIFVVGAVILVLYLF
FFSKTRRIRRSRAEAFEFDIIDTDSEYDSTVDNHDPTARMLSDNDLNDFDFDLSDLEAPE
SPSDTGSATAAPHSKNDRSLSTIAENPFEAGDEGIPQSEQGANHKYTK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

ABL203Wp contains a PF00082 domain.

ABL203Wp contains a PF01483 domain.

ABL203Wp is proteolytically cut by kexin (S08.070) cleavage. LAKR-MPIR.

ABL203Wp is proteolytically cut by kexin (S08.070) cleavage. LAKR-MPIR.