Pulmonary surfactant-associated protein B

UniProt : P07988, UniProt ID: PSPB_HUMAN,

Pulmonary surfactant-associated protein B

Homo sapiens

MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVW
GHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYF
PLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPV
LPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPL
VAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECH
LCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTC
QALGVCGTMSSPLQCIHSPDL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Pulmonary surfactant-associated protein B contains a PF02199 domain.

Pulmonary surfactant-associated protein B contains a PF03489 domain.

Pulmonary surfactant-associated protein B contains a PF05184 domain.

Pulmonary surfactant-associated protein B contains a PF03489 domain.

Pulmonary surfactant-associated protein B contains a PF03489 domain.

Pulmonary surfactant-associated protein B is proteolytically cut by () cleavage..

Pulmonary surfactant-associated protein B is proteolytically cut by napsin A (A01.046) cleavage. LPVL-PGAL.

Pulmonary surfactant-associated protein B is proteolytically cut by cathepsin H (C01.040) cleavage. ALQA-RPGP.

Pulmonary surfactant-associated protein B is proteolytically cut by cathepsin H (C01.040) cleavage. RCSM-DDSA.

Pulmonary surfactant-associated protein B is proteolytically cut by cathepsin H (C01.040) cleavage. SEQA-IPQA.

Pulmonary surfactant-associated protein B is proteolytically cut by cathepsin H (C01.040) cleavage. LLTL-VPRG.

Pulmonary surfactant-associated protein B is proteolytically cut by cathepsin H (C01.040) cleavage. QCIH-SPDL.