cDNA FLJ30169 fis, clone BRACE2000864, highly similar to TUBULIN ALPHA-4 CHAIN (Tubulin, alpha 1 (Testis specific), isoform CRA_b)

UniProt : B3KNQ6, P68366, UniProt ID: B3KNQ6_HUMAN, TBA4A_HUMAN,

cDNA FLJ30169 fis, clone BRACE2000864, highly similar to TUBULIN ALPHA-4 CHAIN (Tubulin, alpha 1 (Testis specific), isoform CRA_b)

Homo sapiens

MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK
HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD
RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGIDSYEDEDEGEE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ30169 fis, clone BRACE2000864, highly similar to TUBULIN ALPHA-4 CHAIN (Tubulin, alpha 1 (Testis specific), isoform CRA_b) contains a PF03953 domain.

cDNA FLJ30169 fis, clone BRACE2000864, highly similar to TUBULIN ALPHA-4 CHAIN (Tubulin, alpha 1 (Testis specific), isoform CRA_b) contains a PF00091 domain.

cDNA FLJ30169 fis, clone BRACE2000864, highly similar to TUBULIN ALPHA-4 CHAIN (Tubulin, alpha 1 (Testis specific), isoform CRA_b) is proteolytically cut by (U9E.002) cleavage. EGEE-Y---.