cDNA, FLJ96348, Homo sapiens tubulin, alpha 8 (TUBA8), mRNA (Tubulin, alpha 8, isoform CRA_a)

UniProt : B2RCX2, Q9NY65, UniProt ID: B2RCX2_HUMAN, TBA8_HUMAN,

cDNA, FLJ96348, Homo sapiens tubulin, alpha 8 (TUBA8), mRNA (Tubulin, alpha 8, isoform CRA_a)

Homo sapiens

MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGNGK
HVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLD
RIRKLTDACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNS
QMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGTDSFEEENEGEEF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ96348, Homo sapiens tubulin, alpha 8 (TUBA8), mRNA (Tubulin, alpha 8, isoform CRA_a) contains a PF03953 domain.

cDNA, FLJ96348, Homo sapiens tubulin, alpha 8 (TUBA8), mRNA (Tubulin, alpha 8, isoform CRA_a) contains a PF00091 domain.

cDNA, FLJ96348, Homo sapiens tubulin, alpha 8 (TUBA8), mRNA (Tubulin, alpha 8, isoform CRA_a) is proteolytically cut by (U9E.002) cleavage. EGEE-F---.