Tubulin, alpha 2 (Tubulin, alpha 2, isoform CRA_b) (cDNA FLJ77591, highly similar to Homo sapiens tubulin, alpha 2 (TUBA2), transcript variant 1, mRNA)

UniProt : Q13748, Q1ZYQ1, UniProt ID: Q1ZYQ1_HUMAN, TBA3C_HUMAN,

Tubulin, alpha 2 (Tubulin, alpha 2, isoform CRA_b) (cDNA FLJ77591, highly similar to Homo sapiens tubulin, alpha 2 (TUBA2), transcript variant 1, mRNA)

Homo sapiens

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEAEAEEGEEY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tubulin, alpha 2 (Tubulin, alpha 2, isoform CRA_b) (cDNA FLJ77591, highly similar to Homo sapiens tubulin, alpha 2 (TUBA2), transcript variant 1, mRNA) contains a PF00091 domain.

Tubulin, alpha 2 (Tubulin, alpha 2, isoform CRA_b) (cDNA FLJ77591, highly similar to Homo sapiens tubulin, alpha 2 (TUBA2), transcript variant 1, mRNA) contains a PF03953 domain.

Tubulin, alpha 2 (Tubulin, alpha 2, isoform CRA_b) (cDNA FLJ77591, highly similar to Homo sapiens tubulin, alpha 2 (TUBA2), transcript variant 1, mRNA) is proteolytically cut by (U9E.002) cleavage. EGEE-Y---.