Tubulin, alpha 3, isoform CRA_a

UniProt : A8K0B8, Q71U36, UniProt ID: A8K0B8_HUMAN, TBA1A_HUMAN,

Tubulin, alpha 3, isoform CRA_a

Homo sapiens

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tubulin, alpha 3, isoform CRA_a contains a PF00091 domain.

Tubulin, alpha 3, isoform CRA_a contains a PF03953 domain.

Tubulin, alpha 3, isoform CRA_a is proteolytically cut by granzyme B, human-type (S01.010) cleavage. FVDL-EPTV.

Tubulin, alpha 3, isoform CRA_a is proteolytically cut by granzyme B, human-type (S01.010) cleavage. FMVD-NEAI.

Tubulin, alpha 3, isoform CRA_a is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VDNE-AIYD.

Tubulin, alpha 3, isoform CRA_a is proteolytically cut by granzyme B, human-type (S01.010) cleavage. PGGD-LAKV.

Tubulin, alpha 3, isoform CRA_a is proteolytically cut by granzyme B, human-type (S01.010) cleavage. FHPE-QLIT.