L antigen family member 3

UniProt : Q14657, UniProt ID: LAGE3_HUMAN,

L antigen family member 3

Homo sapiens

MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRP
HIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISV
INFLDQLSLVVRTMQRFGPPVSR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

L antigen family member 3 contains a PF09341 domain.

L antigen family member 3 is proteolytically cut by caspase () cleavage. GGVD-TAAA.