SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b)

UniProt : P09486, Q6IBK4, UniProt ID: Q6IBK4_HUMAN, SPRC_HUMAN,

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b)

Homo sapiens

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD
LVI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) contains a PF00050 domain.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) contains a PF09289 domain.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. CPAP-IGEF.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. TVAE-VTEV.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. HPVE-LLAR.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. GANP-VQVE.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. NPVQ-VEVG.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. HPVE-LLAR.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. ELAP-LRAP.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. TVAE-VTEV.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GANP-VQVE.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. HPVE-LLAR.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GANP-VQVE.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. NPVQ-VEVG.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. HPVE-LLAR.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. TVAE-VTEV.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EVGE-FDDG.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. HPVE-LLAR.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. ELAP-LRAP.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. ELAP-LRAP.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. ELAP-LRAP.

SPARC protein (Secreted protein, acidic, cysteine-rich (Osteonectin), isoform CRA_b) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. FPLR-MRDW.