PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment)

UniProt : P19957, Q6FG74, UniProt ID: ELAF_HUMAN, Q6FG74_HUMAN,

PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment)

Homo sapiens

MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVK
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment) contains a PF00095 domain.

PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment) is proteolytically cut by elastase-2 (S01.131) cleavage. QEPV-KGPV.

PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment) is proteolytically cut by elastase-2 (S01.131) cleavage. KGPV-STKP.

PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment) is proteolytically cut by elastase-2 (S01.131) cleavage. IRCA-MLNP.

PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment) is proteolytically cut by cathepsin L (C01.032) cleavage. DKVK-AQEP.

PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment) is proteolytically cut by cathepsin K (C01.036) cleavage. DKVK-AQEP.

PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment) is proteolytically cut by plasmin (S01.233) cleavage. DKVK-AQEP.

PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment) is proteolytically cut by trypsin (S01.127) cleavage. DKVK-AQEP.

PI3 protein (Peptidase inhibitor 3, skin-derived (SKALP), isoform CRA_a) (Fragment) is proteolytically cut by tryptase (S01.143) cleavage. DKVK-AQEP.