Integrin beta-3

UniProt : P05106, UniProt ID: ITB3_HUMAN,

Integrin beta-3

Homo sapiens

MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Integrin beta-3 contains a PF08725 domain.

Integrin beta-3 contains a PF07974 domain.

Integrin beta-3 contains a PF07965 domain.

Integrin beta-3 contains a PF07974 domain.

Integrin beta-3 contains a PF07974 domain.

Integrin beta-3 contains a PF00362 domain.

Integrin beta-3 is proteolytically cut by calpain-1 (C02.001) cleavage. NITY-RGT.

Integrin beta-3 is proteolytically cut by calpain-1 (C02.001) cleavage. TSTF-TNIT.

Integrin beta-3 is proteolytically cut by calpain-1 (C02.001) cleavage. NPLY-KEAT.

Integrin beta-3 is proteolytically cut by calpain-1 (C02.001) cleavage. KWDT-ANNP.

Integrin beta-3 is proteolytically cut by calpain-1 (C02.001) cleavage. EERA-RAKW.

Integrin beta-3 is proteolytically cut by calpain-1 (C02.001) cleavage. NITY-RGT-.

Integrin beta-3 is proteolytically cut by calpain-1 (C02.001) cleavage. NPLY-KEAT.

Integrin beta-3 is proteolytically cut by calpain-1 (C02.001) cleavage. KWDT-ANNP.

Integrin beta-3 is proteolytically cut by calpain-1 (C02.001) cleavage. TSTF-TNIT.

Integrin beta-3 is proteolytically cut by calpain-1 (C02.001) cleavage. EERA-RAKW.

Integrin beta-3 is proteolytically cut by cathepsin G (S01.133) cleavage..