Amphiregulin (Schwannoma-derived growth factor)

UniProt : P15514, Q5U026, UniProt ID: AREG_HUMAN, Q5U026_HUMAN,

Amphiregulin (Schwannoma-derived growth factor)

Homo sapiens

MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKK
LRQENGNVHAIA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Amphiregulin (Schwannoma-derived growth factor) contains a PF00008 domain.

Amphiregulin (Schwannoma-derived growth factor) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. EYDN-EPQI.

Amphiregulin (Schwannoma-derived growth factor) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. EYDN-EPQI.

Amphiregulin (Schwannoma-derived growth factor) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. KSMK-THSM.

Amphiregulin (Schwannoma-derived growth factor) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. RVEQ-VVKP.

Amphiregulin (Schwannoma-derived growth factor) is proteolytically cut by () cleavage. IVDD-SVRV.

Amphiregulin (Schwannoma-derived growth factor) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..