Osteocalcin

UniProt : P02818, UniProt ID: OSTC_HUMAN,

Osteocalcin

Homo sapiens

MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
VPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Osteocalcin contains a PF00594 domain.

Osteocalcin is proteolytically cut by cathepsin S (C01.034) cleavage. QWLG-APVP.

Osteocalcin is proteolytically cut by cathepsin D (A01.009) cleavage. FQEA-YRRF.

Osteocalcin is proteolytically cut by cathepsin H (C01.040) cleavage. QWLG-APVP.

Osteocalcin is proteolytically cut by cathepsin H (C01.040) cleavage. EAYR-RFYG.

Osteocalcin is proteolytically cut by cathepsin B (C01.060) cleavage. AYRR-FYGP.

Osteocalcin is proteolytically cut by cathepsin B (C01.060) cleavage. QWLG-APVP.