Coagulation factor XII

UniProt : P00748, UniProt ID: FA12_HUMAN,

Coagulation factor XII

Homo sapiens

MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHK
CTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCL
CPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRT
NPCLHGGRCLEVEGHRLCHCPVGYTGPFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQP
WASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQ
AAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCG
QRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP
EDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSP
YVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGS
SILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYT
DVAYYLAWIREHTVS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Coagulation factor XII contains a PF00039 domain.

Coagulation factor XII contains a PF00089 domain.

Coagulation factor XII contains a PF00051 domain.

Coagulation factor XII contains a PF00040 domain.

Coagulation factor XII contains a PF00008 domain.

Coagulation factor XII contains a PF00008 domain.

Coagulation factor XII is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. VVGG-LVAL.

Coagulation factor XII is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. VVGG-LVAL.

Coagulation factor XII is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. VVGG-LVAL.

Coagulation factor XII is proteolytically cut by plasma kallikrein (S01.212) cleavage. SMTR-VVGG.

Coagulation factor XII is proteolytically cut by coagulation factor XIIa (S01.211) cleavage. SMTR-VVGG.

Coagulation factor XII is proteolytically cut by kallikrein hK1 (S01.160) cleavage. SLTR-NGPL.

Coagulation factor XII is proteolytically cut by kallikrein hK1 (S01.160) cleavage. CGQR-LRKS.

Coagulation factor XII is proteolytically cut by kallikrein hK1 (S01.160) cleavage. SMTR-VVGG.

Coagulation factor XII is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. VVGG-LVAL.

Coagulation factor XII is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. QPPS-LTRN.

Coagulation factor XII is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. APKE-HKYK.

Coagulation factor XII is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. EPKK-VKDH.

Coagulation factor XII is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. QPPS-LTRN.