Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a)

UniProt : Q53XS3, UniProt ID: Q53XS3_HUMAN,

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a)

Homo sapiens

MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) contains a PF00089 domain.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) contains a PF00051 domain.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by kallikrein hK4 (S01.251) cleavage..

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by kallikrein hK15 (S01.081) cleavage..

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by kallikrein hK4 (S01.251) cleavage..

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by kallikrein hK15 (S01.081) cleavage..

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage..

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by kallikrein hK4 (S01.251) cleavage..

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by kallikrein hK15 (S01.081) cleavage..

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage..

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by plasmin (S01.233) cleavage. PRFK-IIGG.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by plasmin (S01.233) cleavage. ADGK-KPSS.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by thrombin (S01.217) cleavage. LRPR-FKII.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by plasma kallikrein (S01.212) cleavage. PRFK-IIGG.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by trypsin 1 (S01.151) cleavage. PRFK-IIGG.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by cathepsin G (S01.133) cleavage. PRFK-IIGG.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by neutrophil elastase (S01.131) cleavage. RFKI-IGGE.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. PPEE-LKFQ.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. PPEE-LKFQ.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by thermolysin (M04.001) cleavage. PRFK-IIGG.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by cathepsin L (C01.032) cleavage. PRFK-IIGG.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by matriptase (S01.302) cleavage..

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by hepsin (S01.224) cleavage. PRFK-IIGG.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by cathepsin B (C01.060) cleavage. PRFK-IIGG.

Plasminogen activator, urokinase (Plasminogen activator, urokinase, isoform CRA_a) is proteolytically cut by matriptase-2 (S01.308) cleavage..