Protein PIR3

UniProt : Q03180, UniProt ID: PIR3_YEAST,

Protein PIR3

Saccharomyces cerevisiae

MQYKKPLVVSALAATSLAAYAPKDPWSTLTPSATYKGGITDYSSSFGIAIEAVATSASSV
ASSKAKRAASQIGDGQVQAATTTAAVSKKSTAAAVSQITDGQVQAAKSTAAAASQISDGQ
VQAAKSTAAAVSQITDGQVQAAKSTAAAVSQITDGQVQAAKSTAAAASQISDGQVQAAKS
TAAAVSQITDGQVQAAKSTAAAASQISDGQVQATTSTKAAASQITDGQIQASKTTSGASQ
VSDGQVQATAEVKDANDPVDVVSCNNNSTLSMSLSKGILTDRKGRIGSIVANRQFQFDGP
PPQAGAIYAAGWSITPEGNLALGDQDTFYQCLSGDFYNLYDKHIGSQCHEVYLQAIDLID
C

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein PIR3 contains a PF00399 domain.

Protein PIR3 contains a PF00399 domain.

Protein PIR3 contains a PF00399 domain.

Protein PIR3 contains a PF00399 domain.

Protein PIR3 contains a PF00399 domain.

Protein PIR3 contains a PF00399 domain.

Protein PIR3 contains a PF00399 domain.

Protein PIR3 contains a PF00399 domain.

Protein PIR3 contains a PF00399 domain.

Protein PIR3 contains a PF00399 domain.

Protein PIR3 is proteolytically cut by kexin (S08.070) cleavage. KAKR-AASQ.