Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA)

UniProt : Q8IV47, UniProt ID: Q8IV47_HUMAN,

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA)

Homo sapiens

MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEG
PAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSI
QEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRE
LHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPD
GLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDL
SYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAM
PADAPLCLRLASLIEI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) contains a PF00560 domain.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) contains a PF00560 domain.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) contains a PF00560 domain.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) contains a PF00560 domain.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) contains a PF00560 domain.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) contains a PF00560 domain.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) contains a PF00560 domain.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) contains a PF00560 domain.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) contains a PF00560 domain.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) contains a PF01462 domain.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. LYME-HNNV.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. PDSY-FRGA.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. SYNQ-LQKI.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. ENLY-LQGN.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. PVNT-NLEN.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. NLEN-LYLQ.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. NEFS-ISSF.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. SLRE-LHLD.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. VPNN-ALEG.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. SLRE-LHLD.

Fibromodulin (Fibromodulin, isoform CRA_a) (cDNA FLJ75875, highly similar to Homo sapiens fibromodulin (FMOD), mRNA) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. VPNN-ALEG.