cDNA FLJ43236 fis, clone HCHON2004531, highly similar to UV excision repair protein RAD23 homolog B (RAD23 homolog B (S. cerevisiae), isoform CRA_b)

UniProt : B3KWK8, P54727, UniProt ID: B3KWK8_HUMAN, RD23B_HUMAN,

cDNA FLJ43236 fis, clone HCHON2004531, highly similar to UV excision repair protein RAD23 homolog B (RAD23 homolog B (S. cerevisiae), isoform CRA_b)

Homo sapiens

MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK
EYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPT
STPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDA
TSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVD
PPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYI
QVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ43236 fis, clone HCHON2004531, highly similar to UV excision repair protein RAD23 homolog B (RAD23 homolog B (S. cerevisiae), isoform CRA_b) contains a PF00240 domain.

cDNA FLJ43236 fis, clone HCHON2004531, highly similar to UV excision repair protein RAD23 homolog B (RAD23 homolog B (S. cerevisiae), isoform CRA_b) contains a PF00627 domain.

cDNA FLJ43236 fis, clone HCHON2004531, highly similar to UV excision repair protein RAD23 homolog B (RAD23 homolog B (S. cerevisiae), isoform CRA_b) contains a PF00627 domain.

cDNA FLJ43236 fis, clone HCHON2004531, highly similar to UV excision repair protein RAD23 homolog B (RAD23 homolog B (S. cerevisiae), isoform CRA_b) contains a PF09280 domain.

cDNA FLJ43236 fis, clone HCHON2004531, highly similar to UV excision repair protein RAD23 homolog B (RAD23 homolog B (S. cerevisiae), isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. TATD-STSG.