Chemokine (C-C motif) ligand 3-like 1

UniProt : B2RUX4, P16619, UniProt ID: B2RUX4_HUMAN, CL3L1_HUMAN,

Chemokine (C-C motif) ligand 3-like 1

Homo sapiens

MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSK
PSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Chemokine (C-C motif) ligand 3-like 1 contains a PF00048 domain.

Chemokine (C-C motif) ligand 3-like 1 is proteolytically cut by dipeptidyl-peptidase IV (S09.003) cleavage. LSAP-LAAD.