Homo sapiens

MQVCSQPQRGCVREQSAINTAPPSAHNAASPGGARGHRVPLTEACKDSRIGGMMKTLLLF
VGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERK
TLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARV
CRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIID
ELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFL
EMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREI
LSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNW
VSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNP
KFMETVAEKALQEYRKKHREE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QAMD-IHFH.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. PPTE-FIRE.

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. QAMD-IHFH.

is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. PPTE-FIRE.

is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. QVLG-DQTV.

is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. KYVN-KEIQ.

is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. KFME-TVAE.

is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. ALQE-YRKK.

is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. LPHR-RPHF.

is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. SRIV-RSLM.

is proteolytically cut by matrix metallopeptidase-12 (MER001089) cleavage. QIKT-LIEK.

is proteolytically cut by matrix metallopeptidase-12 (MER001089) cleavage. LLSN-LEEA.