Isoform 2 of Cell division control protein 42 homolog

UniProt : P60953, UniProt ID: P60953-2,

Isoform 2 of Cell division control protein 42 homolog

Homo sapiens

MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Cell division control protein 42 homolog contains a PF00071 domain.

Isoform 2 of Cell division control protein 42 homolog is proteolytically cut by caspase-7 (C14.004) cleavage. DLRD-DPST.

Isoform 2 of Cell division control protein 42 homolog is proteolytically cut by caspase-3 (C14.003) cleavage. DLRD-DPST.

Isoform 2 of Cell division control protein 42 homolog is proteolytically cut by caspase-3 (C14.003) cleavage. TQID-LRDD.

Isoform 2 of Cell division control protein 42 homolog is proteolytically cut by Ulp1 peptidase (C48.001) cleavage. PKRK-CCIF.