Brain-derived neurotrophic factor BDNF6B (Brain-derived neurotrophic factor, isoform CRA_b) (Brain derived neurotrophic factor variant)

UniProt : Q6YNR2, UniProt ID: Q6YNR2_HUMAN,

Brain-derived neurotrophic factor BDNF6B (Brain-derived neurotrophic factor, isoform CRA_b) (Brain derived neurotrophic factor variant)

Homo sapiens

MQSREEEWFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLES
VNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPP
LLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVT
VLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKR
IGWRFIRIDTSCVCTLTIKRGR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Brain-derived neurotrophic factor BDNF6B (Brain-derived neurotrophic factor, isoform CRA_b) (Brain derived neurotrophic factor variant) contains a PF00243 domain.

Brain-derived neurotrophic factor BDNF6B (Brain-derived neurotrophic factor, isoform CRA_b) (Brain derived neurotrophic factor variant) is proteolytically cut by plasmin (S01.233) cleavage. MSMR-VRRH.