Regulator of G-protein signalling 10 (Regulator of G-protein signalling 10, isoform CRA_b)

UniProt : B1AMR8, O43665, UniProt ID: B1AMR8_HUMAN, RGS10_HUMAN,

Regulator of G-protein signalling 10 (Regulator of G-protein signalling 10, isoform CRA_b)

Homo sapiens

MQSELCFADIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENV
LFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQ
KLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Regulator of G-protein signalling 10 (Regulator of G-protein signalling 10, isoform CRA_b) contains a PF00615 domain.

Regulator of G-protein signalling 10 (Regulator of G-protein signalling 10, isoform CRA_b) is proteolytically cut by caspase () cleavage. HDSD-GSSS.