Putative uncharacterized protein

UniProt : A8K9N4, P00740, UniProt ID: A8K9N4_HUMAN, FA9_HUMAN,

Putative uncharacterized protein

Homo sapiens

MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNL
ERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCP
FGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGR
VSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPW
QVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEETEHTEQKRNVIRII
PHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVF
HKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE
GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00594 domain.

Putative uncharacterized protein contains a PF00089 domain.

Putative uncharacterized protein contains a PF00008 domain.

Putative uncharacterized protein contains a PF00008 domain.

Putative uncharacterized protein is proteolytically cut by hepsin (S01.224) cleavage. DFTR-VVGG.

Putative uncharacterized protein is proteolytically cut by gingipain R (C25.001) cleavage. KLTR-AETV.

Putative uncharacterized protein is proteolytically cut by gingipain R (C25.001) cleavage. DFTR-VVGG.

Putative uncharacterized protein is proteolytically cut by gingipain R (C25.001) cleavage. RPKR-YNSG.

Putative uncharacterized protein is proteolytically cut by hepsin (S01.224) cleavage. DFTR-VVGG.

Putative uncharacterized protein is proteolytically cut by gingipain R (C25.001) cleavage. KLTR-AETV.

Putative uncharacterized protein is proteolytically cut by gingipain R (C25.001) cleavage. DFTR-VVGG.

Putative uncharacterized protein is proteolytically cut by gingipain R (C25.001) cleavage. RPKR-YNSG.

Putative uncharacterized protein is proteolytically cut by elastase-2 (S01.131) cleavage. TQST-QSFN.

Putative uncharacterized protein is proteolytically cut by hepsin (S01.224) cleavage. DFTR-VVGG.

Putative uncharacterized protein is proteolytically cut by gingipain R (C25.001) cleavage. KLTR-AETV.

Putative uncharacterized protein is proteolytically cut by gingipain R (C25.001) cleavage. DFTR-VVGG.

Putative uncharacterized protein is proteolytically cut by gingipain R (C25.001) cleavage. RPKR-YNSG.

Putative uncharacterized protein is proteolytically cut by elastase-2 (S01.131) cleavage. TQST-QSFN.

Putative uncharacterized protein is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. DFTR-VVGG.

Putative uncharacterized protein is proteolytically cut by coagulation factor VIIa (S01.215) cleavage. KLTR-AETV.

Putative uncharacterized protein is proteolytically cut by coagulation factor XIa (S01.213) cleavage. DFTR-VVGG.

Putative uncharacterized protein is proteolytically cut by coagulation factor XIa (S01.213) cleavage. KLTR-AETV.

Putative uncharacterized protein is proteolytically cut by russellysin (M12.158) cleavage. RPKR-YNSG.

Putative uncharacterized protein is proteolytically cut by furin (S08.071) cleavage. RPKR-YNSG.

Putative uncharacterized protein is proteolytically cut by thermolysin (M04.001) cleavage. QTSK-LTRA.

Putative uncharacterized protein is proteolytically cut by thermolysin (M04.001) cleavage. SFND-FTRV.

Putative uncharacterized protein is proteolytically cut by thrombin (S01.217) cleavage. QYLR-VPLV.

Putative uncharacterized protein is proteolytically cut by thrombin (S01.217) cleavage. HKGR-SALV.

Putative uncharacterized protein is proteolytically cut by thrombin (S01.217) cleavage. TCLR-STKF.

Putative uncharacterized protein is proteolytically cut by elastase-2 (S01.131) cleavage. FTRV-VGGE.

Putative uncharacterized protein is proteolytically cut by elastase-2 (S01.131) cleavage. AETI-LDNI.

Putative uncharacterized protein is proteolytically cut by elastase-2 (S01.131) cleavage. SKLT-RAET.

Putative uncharacterized protein is proteolytically cut by elastase-2 (S01.131) cleavage. VSQT-SKLT.