PTHLH protein (Parathyroid hormone-like hormone, isoform CRA_b) (Fragment)
|
UniProt : P12272, Q6FH74, UniProt ID: PTHR_HUMAN, Q6FH74_HUMAN, PTHLH protein (Parathyroid hormone-like hormone, isoform CRA_b) (Fragment) Homo sapiens MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFL HHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLK TPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
PTHLH protein (Parathyroid hormone-like hormone, isoform CRA_b) (Fragment) contains a PF01279 domain.
PTHLH protein (Parathyroid hormone-like hormone, isoform CRA_b) (Fragment) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RRFF-LHHL.