Isoform 2 of Parathyroid hormone-related protein

UniProt : P12272, Q53XY9, UniProt ID: P12272-2, Q53XY9_HUMAN,

Isoform 2 of Parathyroid hormone-related protein

Homo sapiens

MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFL
HHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLK
TPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Parathyroid hormone-related protein contains a PF01279 domain.

Isoform 2 of Parathyroid hormone-related protein is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RRFF-LHHL.

Isoform 2 of Parathyroid hormone-related protein is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RRFF-LHHL.