Kallikrein-11

UniProt : Q9UBX7, UniProt ID: KLK11_HUMAN,

Kallikrein-11

Homo sapiens

MQRLRWLRDWKSSGRGLTAAKEPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFEC
KPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRT
ATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWG
STSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLV
CNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kallikrein-11 contains a PF00089 domain.

Kallikrein-11 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. PQLR-LPHT.

Kallikrein-11 is proteolytically cut by plasmin (S01.233) cleavage. PQLR-LPHT.

Kallikrein-11 is proteolytically cut by () cleavage. GETR-IIKG.