Cadherin-5

UniProt : P33151, UniProt ID: CADH5_HUMAN,

Cadherin-5

Homo sapiens

MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
NTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
VIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADD
PTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSG
TATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVI
INITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFA
KPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFTLNTENNFTLTDNHDNTANITVKY
GQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDG
DGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPRE
ELLY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cadherin-5 contains a PF00028 domain.

Cadherin-5 contains a PF00028 domain.

Cadherin-5 contains a PF00028 domain.

Cadherin-5 contains a PF00028 domain.

Cadherin-5 contains a PF01049 domain.

Cadherin-5 contains a PF00028 domain.

Cadherin-5 is proteolytically cut by gingipain R1 (C25.001) cleavage..

Cadherin-5 is proteolytically cut by gingipain R2 (C25.003) cleavage..

Cadherin-5 is proteolytically cut by gingipain K (C25.002) cleavage..

Cadherin-5 is proteolytically cut by gingipain R1 (C25.001) cleavage..

Cadherin-5 is proteolytically cut by gingipain R2 (C25.003) cleavage..

Cadherin-5 is proteolytically cut by gingipain K (C25.002) cleavage..

Cadherin-5 is proteolytically cut by matrix metallopeptidase () cleavage..