Gastrin
|
UniProt : P01350, UniProt ID: GAST_HUMAN, Gastrin Homo sapiens MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Gastrin contains a PF00918 domain.
Gastrin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. PSKK-QGPW.
Gastrin is proteolytically cut by meprin beta subunit (M12.004) cleavage. WLEE-EEEA.
Gastrin is proteolytically cut by meprin beta subunit (M12.004) cleavage. LEEE-EEAY.
Gastrin is proteolytically cut by meprin beta subunit (M12.004) cleavage. PWLE-EEEE.
Gastrin is proteolytically cut by meprin beta subunit (M12.004) cleavage. GPWL-EEEE.
Gastrin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. DPSK-KQGP.
Gastrin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. DFGR-RSAE.
Gastrin is proteolytically cut by neprilysin (M13.001) cleavage. QGPW-LEEE.
Gastrin is proteolytically cut by neprilysin (M13.001) cleavage. EEEA-YGWM.
Gastrin is proteolytically cut by neprilysin (M13.001) cleavage. EAYG-WMDF.
Gastrin is proteolytically cut by neprilysin (M13.001) cleavage. GWMD-FGRR.
Gastrin is proteolytically cut by carboxypeptidase E (M14.005) cleavage. MDFG-RRSA.