A disintegrin and metalloproteinase with thrombospondin motifs 1

UniProt : Q9UHI8, UniProt ID: ATS1_HUMAN,

A disintegrin and metalloproteinase with thrombospondin motifs 1

Homo sapiens

MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEEL
VVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDL
AHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAP
LQFHLLRRNRQGDVGGTCGVVDDEPRPTGKAETEDEDEGTEGEDEGAQWSPQDPALQGVG
QPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRN
SVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQD
LCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL
NGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGT
SYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWC
INGKCVNKTDRKHFDTPFHGSWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNLEDCPDNNGKTFREEQCEAHNEFSKASFGSGPAVEWIPKYAGVSPKDRCKL
ICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGVCGGN
GSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILN
GDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY
FVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPAS
TRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDF
CTMAECS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

A disintegrin and metalloproteinase with thrombospondin motifs 1 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 1 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 1 contains a PF00090 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 1 contains a PF01421 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 1 contains a PF01562 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 1 contains a PF05986 domain.

A disintegrin and metalloproteinase with thrombospondin motifs 1 is proteolytically cut by furin (S08.071) cleavage. RKKR-FVSS.

A disintegrin and metalloproteinase with thrombospondin motifs 1 is proteolytically cut by furin (S08.071) cleavage. RKKR-FVSS.

A disintegrin and metalloproteinase with thrombospondin motifs 1 is proteolytically cut by PACE4 proprotein convertase (S08.075) cleavage..

A disintegrin and metalloproteinase with thrombospondin motifs 1 is proteolytically cut by proprotein convertase 5 (S08.076) cleavage..