PMAP: SubstrateDB : Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d)

UniProt : A4D2F5, P17936, UniProt ID: A4D2F5_HUMAN, IBP3_HUMAN,

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d)

Homo sapiens

MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) contains a PF00086 domain.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) contains a PF00219 domain.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by kallikrein hK2 (S01.161) cleavage..

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LRAY-LLPA.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. APGN-ASES.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by thrombin (S01.217) cleavage. SRLR-AYLL.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by thrombin (S01.217) cleavage. LSPR-GVHI.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ESKR-ETEY.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. TQNF-SSES.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SQRY-KVDY.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SRLR-AYLL.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. STHR-VSDP.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SQRY-KVDY.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SSTH-RVSD.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by plasmin (S01.233) cleavage. SRLR-AYLL.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by plasmin (S01.233) cleavage. QRYK-VDYE.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by plasmin (S01.233) cleavage. AVSR-LRAY.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. LRAY-LLPA.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. VSRL-RAYL.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. LRAY-LLPA.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. FHPL-HSKI.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. RAYL-LPAP.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by cathepsin D (A01.009) cleavage. RYKV-DYES.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by cathepsin G (S01.133) cleavage. KFLN-VLSP.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by cathepsin G (S01.133) cleavage. PLHS-KIII.

Insulin-like growth factor binding protein 3 (Insulin-like growth factor binding protein 3, isoform CRA_d) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. FSSE-SKRE.