Homo sapiens

MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGEPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIII
IKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRG
VHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by kallikrein hK2 (S01.161) cleavage..

is proteolytically cut by kallikrein hK2 (S01.161) cleavage..

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. AVSR-LRAY.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LHSK-IIII.

is proteolytically cut by matrix metallopeptidase-19 (M10.021) cleavage..

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..

is proteolytically cut by kallikrein hK2 (S01.161) cleavage..

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. AVSR-LRAY.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LHSK-IIII.

is proteolytically cut by matrix metallopeptidase-19 (M10.021) cleavage..

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage..

is proteolytically cut by kallikrein hK14 (S01.029) cleavage..