Isoform 2 of ADAM 28

UniProt : Q9JLN6, UniProt ID: Q9JLN6-2,

Isoform 2 of ADAM 28

Mus musculus

MQQWSLLVVSFLLSPVPVSAIKELPKAKKYEVVYPIRLHPLRKRETQEPEPKETFETELR
YKMTVNGKVAVLYLKKNNKLLAPDYSETYYNSSGNKVTTSPQIMDSCYYQGHIVNEKVSA
ASISTCQGLRGYISQGDEKYFIEPLSSENLDEQAHALFKDDSNEDQEKSNCGVDDALWLQ
GLHQDVALPATRLIKLNDGMVQEPKKYIEYYVVLDNGEFKKYNKNLAEIRKIVLEMANYI
NMLYNKLDAHVALVGVEIWTDGDKIKITPDANTTLENFSKWRGNDLLKRKHHDIAQLISS
TDFSGSTVGLAFMSSMCSPYHSVGIVQDHSNYHLRVAGTMAHEMGHNLGMIHDYLSCKCP
SEVCVMEQSLRFHMPTDFSSCSRVNYKQFLEEKLSHCLFNSPLPSDIISTPVCGNQLLEM
NEDCDCGTPKECTNKCCDARTCKIKAGFQCALGECCEKCQLKKPGVVCRAAKDECDLPEV
CDGKSSHCPGDRFRVNGSPCQNGHGYCLKGKCPTLQQQCMDMWGPGTKVANTSCYKQNEG
GTKYGYCHVENGTHMPCKAKDAMCGKLFCEGGSGDLPWKGLTISFLTCKLFDPEDTSQGV
DMVANGTKCGTNKVCINAECVDMEKTYKSANCSSKCKGHAVCDHELQCQCKEGWAPPDCE
NSATVFHFSIVVGVLFPLAVIFVVVAIVIQRQSARRKQRRVQRLPSTKDAKLHNQKCRPQ
KVKDVQPQEMSQMKKLHVSDLPSEEPEPPPDVLITKPNFPPPPIPVSL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of ADAM 28 contains a PF00200 domain.

Isoform 2 of ADAM 28 contains a PF01421 domain.

Isoform 2 of ADAM 28 contains a PF01562 domain.

Isoform 2 of ADAM 28 contains a PF08516 domain.

Isoform 2 of ADAM 28 is proteolytically cut by ADAM28 peptidase (M12.020) cleavage..