Putative uncharacterized protein

UniProt : P41047, Q544E9, UniProt ID: Q544E9_MOUSE, TNFL6_MOUSE,

Putative uncharacterized protein

Mus musculus

MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQ
PLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSL
KVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLV
INETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHS
SYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00229 domain.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. ELAE-LREF.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. TNQS-LKVS.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LQKE-LAEL.