FAS ligand (TNF superfamily, member 6) (Fas ligand (TNF superfamily, member 6), isoform CRA_b) (cDNA, FLJ95775, Homo sapiens tumor necrosis factor (ligand) superfamily, member 6(TNFSF6), mRNA)

UniProt : P48023, Q53ZZ1, UniProt ID: Q53ZZ1_HUMAN, TNFL6_HUMAN,

FAS ligand (TNF superfamily, member 6) (Fas ligand (TNF superfamily, member 6), isoform CRA_b) (cDNA, FLJ95775, Homo sapiens tumor necrosis factor (ligand) superfamily, member 6(TNFSF6), mRNA)

Homo sapiens

MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQ
MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGG
LVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA
RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

FAS ligand (TNF superfamily, member 6) (Fas ligand (TNF superfamily, member 6), isoform CRA_b) (cDNA, FLJ95775, Homo sapiens tumor necrosis factor (ligand) superfamily, member 6(TNFSF6), mRNA) contains a PF00229 domain.

FAS ligand (TNF superfamily, member 6) (Fas ligand (TNF superfamily, member 6), isoform CRA_b) (cDNA, FLJ95775, Homo sapiens tumor necrosis factor (ligand) superfamily, member 6(TNFSF6), mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LQKE-LAEL.

FAS ligand (TNF superfamily, member 6) (Fas ligand (TNF superfamily, member 6), isoform CRA_b) (cDNA, FLJ95775, Homo sapiens tumor necrosis factor (ligand) superfamily, member 6(TNFSF6), mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. ELAE-LRES.

FAS ligand (TNF superfamily, member 6) (Fas ligand (TNF superfamily, member 6), isoform CRA_b) (cDNA, FLJ95775, Homo sapiens tumor necrosis factor (ligand) superfamily, member 6(TNFSF6), mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. TASS-LEKQ.

FAS ligand (TNF superfamily, member 6) (Fas ligand (TNF superfamily, member 6), isoform CRA_b) (cDNA, FLJ95775, Homo sapiens tumor necrosis factor (ligand) superfamily, member 6(TNFSF6), mRNA) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EKKE-LRKV.