Mating hormone A-factor 1

UniProt : P34165, UniProt ID: MFA1_YEAST,

Mating hormone A-factor 1

Saccharomyces cerevisiae

MQPSTATAAPKEKTSSEKKDNYIIKGVFWDPACVIA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Mating hormone A-factor 1 is proteolytically cut by prenyl peptidase 2 (U48.001) cleavage. DPAC-VIA-.

Mating hormone A-factor 1 is proteolytically cut by Ste24 peptidase (M48.001) cleavage. DPAC-VIA-.

Mating hormone A-factor 1 is proteolytically cut by prenyl peptidase 2 (U48.001) cleavage. DPAC-VIA-.

Mating hormone A-factor 1 is proteolytically cut by Ste24 peptidase (M48.001) cleavage. DPAC-VIA-.

Mating hormone A-factor 1 is proteolytically cut by farnesylated-protein converting enzyme 1 (M48.003) cleavage. DPAC-VIA-.

Mating hormone A-factor 1 is proteolytically cut by Ste24 peptidase (M48.001) cleavage. STAT-AAPK.

Mating hormone A-factor 1 is proteolytically cut by Axl1 peptidase (M16.007) cleavage. KKDN-YIIK.