Notch gene homolog 4 (Drosophila)

UniProt : A2CG28, UniProt ID: A2CG28_MOUSE,

Notch gene homolog 4 (Drosophila)

Mus musculus

MQPQLLLLLLLPLNFPVILTRELLCGGSPEPCANGGTCLRLSRGQGICQCAPGFLGETCQ
FPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCP
PSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQCRCP
PGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSC
LNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCP
KTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAAT
CAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPG
YSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQP
CHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGF
TGARCEKDMDECSSTPCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGAS
CLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAED
NCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMG
LTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCV
NKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQT
LIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNG
GLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSGYVCQCAPGYEGQN
CSKVLDACQSQPCHNHGTCTSRPGGFHCACPPGFVGLRCEGDVDECLDRPCHPSGTAACH
SLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTC
SHKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCLHNG
TCTETPGLGNPGFQCTCPPDSPGPRCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDCS
LGVPDPWKGCPPHSQCWLLFRDGRCHPQCDSEECLFDGYDCEIPLTCIPAYDQYCRDHFH
NGHCEKGCNNAECGWDGGDCRPEGEDSEGRPSLALLVVLRPPALDQQLLALARVLSLTLR
VGLWVRKDSEGRNMVFPYPGTRAKEELSGARDSSSWERQAPPTQPLGKETESLGAGFVVV
MGVDLSRCGPEHPASRCPWDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPQAGTRPSANQ
LPWPILCSPVVGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPQTQQAPHRRRPPL
GEDNIGLKALKPEAEVDEDGVAMCSGPEEGEAEETASASRCQLWPLNSGCGELPQAAMLT
PPQECESEVLDVDTCGPDGVTPLMSAVFCGGVQSTTGASPQRLGLGNLEPWEPLLDRGAC
PQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQL
LLASRQTTVDARTEDGTTPLMLAARLAVEDLVEELIAARADVGARDKRGKTALHWAAAVN
NARAARSLLQAGADKDAQDSREQTPLFLAAREGAVEVAQLLLELGAARGLRDQAGLAPGD
VARQRSHWDLLTLLEGAGPTTQEARAHARTTPGGGAAPRCRTLSAGARPRGGGACLQART
WSVDLGARGGKVYARCRSRSGSCGGPTTRGRRFSAGSRGRRGARASQDDWPRDWVALEAC
GSACSAPIPPPSLTPSPERGSPQVAWGLPVHQEIPLNSVVRNLN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00023 domain.

Notch gene homolog 4 (Drosophila) contains a PF00023 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF07974 domain.

Notch gene homolog 4 (Drosophila) contains a PF07684 domain.

Notch gene homolog 4 (Drosophila) contains a PF07645 domain.

Notch gene homolog 4 (Drosophila) contains a PF07645 domain.

Notch gene homolog 4 (Drosophila) contains a PF07645 domain.

Notch gene homolog 4 (Drosophila) contains a PF00066 domain.

Notch gene homolog 4 (Drosophila) contains a PF00066 domain.

Notch gene homolog 4 (Drosophila) contains a PF00023 domain.

Notch gene homolog 4 (Drosophila) contains a PF00023 domain.

Notch gene homolog 4 (Drosophila) contains a PF00023 domain.

Notch gene homolog 4 (Drosophila) contains a PF00023 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) contains a PF00008 domain.

Notch gene homolog 4 (Drosophila) is proteolytically cut by presenilin 1 (A22.001) cleavage. GALL-VLQL.