Left-right determination factor 1

UniProt : O75610, UniProt ID: LFTY1_HUMAN,

Left-right determination factor 1

Homo sapiens

MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQ
YVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRL
FQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDV
TEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTL
DLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQP
PEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALV
PRRLQP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Left-right determination factor 1 contains a PF00688 domain.

Left-right determination factor 1 contains a PF00019 domain.

Left-right determination factor 1 is proteolytically cut by convertase subtilisin/kexin type 5 () cleavage. RGKR-FSQN.

Left-right determination factor 1 is proteolytically cut by convertase subtilisin/kexin type 5 () cleavage. RHGR-LSPR.