Isoform Tau-A of Microtubule-associated protein tau

UniProt : P10636, UniProt ID: P10636-3,

Isoform Tau-A of Microtubule-associated protein tau

Homo sapiens

MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEA
AGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPA
PKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSS
AKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIH
HKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHG
AEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform Tau-A of Microtubule-associated protein tau contains a PF00418 domain.

Isoform Tau-A of Microtubule-associated protein tau contains a PF00418 domain.

Isoform Tau-A of Microtubule-associated protein tau contains a PF00418 domain.

Isoform Tau-A of Microtubule-associated protein tau contains a PF00418 domain.

Isoform Tau-A of Microtubule-associated protein tau is proteolytically cut by thrombin (S01.217) cleavage. ATPR-GAAP.

Isoform Tau-A of Microtubule-associated protein tau is proteolytically cut by thrombin (S01.217) cleavage. PGSR-SRTP.

Isoform Tau-A of Microtubule-associated protein tau is proteolytically cut by thrombin (S01.217) cleavage. AVVR-TPPK.

Isoform Tau-A of Microtubule-associated protein tau is proteolytically cut by thrombin (S01.217) cleavage. VEVK-SEKL.

Isoform Tau-A of Microtubule-associated protein tau is proteolytically cut by thrombin (S01.217) cleavage. KNVK-SKIG.